Magic film

RafalRafal Posts: 97Member ✭✭
Hallo guys short news maybe, hmmm i hop maybe soon i get film what you don't need use activator ;-)
So only put film on the water wait and dipp.
I wait for results.
Nice

Comments

  • schidroschidro Posts: 376Member ✭✭✭
    How would it adhere to substrate?  
  • RafalRafal Posts: 97Member ✭✭
    Work is underway to create a film that will not need an activator.
    It is already so that the film for printing will be done without an activator
  • RafalRafal Posts: 97Member ✭✭
    If I know something more I will let you know
  • K2ConceptsK2Concepts Posts: 13,444Administrator El Jefe
    Yawn...
  • mielkewaygraphicsmielkewaygraphics Posts: 192Member, Business Ninja ✭✭✭
  • loochlooch Posts: 1,763Member ✭✭✭✭✭
    They have something called wrap here in the states . 
  • smedlinsmedlin Posts: 1,920Member, Business Ninja ✭✭✭✭✭
    I saw a video of that a few months ago.

    it looked liked normal film, but it didn't require manual activation.

    I'm not holding my breath.

    And personally, I don't want it to work out. You think we have a billion "bath-tub dippers" now????
  • schidroschidro Posts: 376Member ✭✭✭
    Stickers you say? Hmmm wonder where they can be gotten? Might need to look into this. No one does this thing around me. I bet I could make a KILLING..........
  • DeviousDipsDeviousDips Posts: 1,713Member ✭✭✭✭
    @smedlin I remember that video. It was one from Dan Zhang. Just soak in water and dip. Can only be applied to waterbased paints is what I was told. 
  • RafalRafal Posts: 97Member ✭✭
    edited August 7
    Ok guys dont troll me i heard this news and i want only share. So now i must drik 7 liter beer for haters :s
  • WileECoyoteWileECoyote Posts: 6,537Member, Moderator, Business Ninja El Moderator
    All good. We aren't blaming you... We have just heard it a few hundred times already.
Sign In or Register to comment.